PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01015363001
Common NameVIT_11s0016g03680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CPP
Protein Properties Length: 525aa    MW: 56663.5 Da    PI: 7.8347
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01015363001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461e-143776242
                TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                       ++k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C+N+ e+
  GSVIVT01015363001 37 KQKQCNCKHSRCLKLYCECFASGIYCDG-CNCVNCHNNVEN 76
                       89**************************.********9875 PP

2TCR51.12.6e-16121160140
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  GSVIVT01015363001 121 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 160
                        589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-173676IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.81837161IPR005172CRC domain
PfamPF036381.0E-113873IPR005172CRC domain
SMARTSM011148.4E-20121162IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.8E-13124159IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MPVPPQTTHP SVRVVKPESP RSRPRPNIDV KDGTPKKQKQ CNCKHSRCLK LYCECFASGI  60
YCDGCNCVNC HNNVENEAAR REAVEVTLER NPNAFRPKIA SSPHGARDSR EESGEALVLG  120
KHNKGCHCKK SGCLKKYCEC FQANILCSEN CKCMDCKNFE GSEERQALFH GDHANSMAYI  180
QQAANAAITG AIGSSGFGSP PVSKKRKGQE LFYGPTSKDP SLHRLAQFQQ ASLTKASVTT  240
SSLSSTPVSR VPNSAASGTS KFTYRSLLAD IIQPQDLKEL CSVLVVVSEE AARTFADKRN  300
LVEKPAEEQV ETSRASSTQD RLQSQKESDI EKAVADDCSS RNQADKLGPD DSSSDGGDVP  360
KGRPMSPGTL ALMCDEQDTM FMAAASPNVL MGHSCNTSSQ LPYGQGITEA YAEQERIILT  420
KFRDCLNRLI TFGEIKETKC SSLARTESGG QNEPFSNGPA NARTDTGNQQ VPVSNGVSKP  480
PFPPATKMSQ TVTAAAASPN NTLLSKPSTH TENGDINLKT EKEL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.147280.0stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4840280.0AM484028.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X101832.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010656307.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_010656305.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_002280793.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLD7TBL30.0D7TBL3_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g03680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14691745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-168Tesmin/TSO1-like CXC domain-containing protein